Human GLP2(Glucagon Like Peptide 2) ELISA Kit

Human GLP2(Glucagon Like Peptide 2) ELISA Kit

To Order: Contact us

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

RD-GLP2-Hu-48Tests 48 Tests
EUR 521

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

RD-GLP2-Hu-96Tests 96 Tests
EUR 723

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

RDR-GLP2-Hu-48Tests 48 Tests
EUR 544

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

RDR-GLP2-Hu-96Tests 96 Tests
EUR 756

Human Glucagon-Like Peptide 2 (GLP2) Peptide

abx670345-1mg 1 mg
EUR 356
  • Shipped within 1 week.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit

4-CED059Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Glucagon Like Peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human GLP2(Glucagon Like Peptide 2) ELISA Kit

EH3143 96T
EUR 524.1
  • Detection range: 0.156-10 ng/ml
  • Alias: GLP2/glucagon-like peptide 2
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

Human Glucagon Like Peptide 2 ELISA Kit (GLP2)

RK01470 96 Tests
EUR 521

Glucagon Like Peptide 2 (GLP2) Antibody

20-abx130461
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody

20-abx178980
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody

20-abx178981
  • EUR 453.00
  • EUR 133.00
  • EUR 1302.00
  • EUR 620.00
  • EUR 342.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody

20-abx178982
  • EUR 467.00
  • EUR 133.00
  • EUR 1358.00
  • EUR 648.00
  • EUR 356.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Recombinant Glucagon Like Peptide 2 (GLP2)

4-RPD059Hu01
  • EUR 413.60
  • EUR 214.00
  • EUR 1276.00
  • EUR 492.00
  • EUR 884.00
  • EUR 340.00
  • EUR 3040.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P01275
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 11.2kDa
  • Isoelectric Point: 4
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: E.coli

Recombinant Glucagon Like Peptide 2 (GLP2)

4-RPD059Mu01
  • EUR 440.48
  • EUR 221.00
  • EUR 1376.80
  • EUR 525.60
  • EUR 951.20
  • EUR 358.00
  • EUR 3292.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P55095
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 33.8kDa
  • Isoelectric Point: 4
Description: Recombinant Mouse Glucagon Like Peptide 2 expressed in: E.coli

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Mu-10x96wellstestplate 10x96-wells test plate
EUR 4862.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Mu-1x48wellstestplate 1x48-wells test plate
EUR 488.08
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Mu-1x96wellstestplate 1x96-wells test plate
EUR 654.4
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Mu-5x96wellstestplate 5x96-wells test plate
EUR 2644.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12
  • Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit

4-CED059Mu
  • EUR 4913.00
  • EUR 2595.00
  • EUR 655.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Glucagon Like Peptide 2 (GLP2) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Po-10x96wellstestplate 10x96-wells test plate
EUR 5647.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Po-1x48wellstestplate 1x48-wells test plate
EUR 552.76
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Po-1x96wellstestplate 1x96-wells test plate
EUR 746.8
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit

CED059Po-5x96wellstestplate 5x96-wells test plate
EUR 3060.6
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit

4-CED059Po
  • EUR 5698.00
  • EUR 3011.00
  • EUR 747.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Pig Glucagon Like Peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Pig glucagon like peptide 2(GLP2) ELISA kit

CSB-EQ027317PI-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig glucagon like peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Pig glucagon like peptide 2(GLP2) ELISA kit

1-CSB-EQ027317PI
  • EUR 900.00
  • EUR 5476.00
  • EUR 2900.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig glucagon like peptide 2(GLP2) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Glucagon Like Peptide 2 ELISA Kit (GLP2)

RK02852 96 Tests
EUR 521

Porcine Glucagon Like Peptide 2 ELISA Kit (GLP2)

RK03328 96 Tests
EUR 573

Human Glucagon Like Peptide 2 (GLP2) Protein

20-abx652336
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-15 working days.

Human Glucagon Like Peptide 2 (GLP2) Peptide (OVA)

20-abx651238
  • EUR 453.00
  • EUR 230.00
  • EUR 1219.00
  • EUR 523.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Human Glucagon Like Peptide 2 (GLP2) Peptide (OVA)

20-abx165542
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

ELISA kit for Human GLP2 (Glucagon Like Peptide 2)

ELK3108 1 plate of 96 wells
EUR 432
  • A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) (
  • Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)

KTE62531-48T 48T
EUR 332
  • GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)

KTE62531-5platesof96wells 5 plates of 96 wells
EUR 2115
  • GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)

KTE62531-96T 96T
EUR 539
  • GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (
  • Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

OVA Conjugated Glucagon Like Peptide 2 (GLP2)

4-CPD059Ca21
  • EUR 413.60
  • EUR 214.00
  • EUR 1276.00
  • EUR 492.00
  • EUR 884.00
  • EUR 340.00
  • EUR 3040.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 1536.6Da
  • Isoelectric Point: Inquire
Description: Recombinant Dog Glucagon Like Peptide 2 expressed in: E.coli

OVA conjugated Glucagon Like Peptide 2 (GLP2)

4-CPD059Hu21
  • EUR 413.60
  • EUR 214.00
  • EUR 1276.00
  • EUR 492.00
  • EUR 884.00
  • EUR 340.00
  • EUR 3040.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P01275
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)

4-CPD059Hu22
  • EUR 312.35
  • EUR 187.00
  • EUR 896.32
  • EUR 365.44
  • EUR 630.88
  • EUR 272.00
  • EUR 2090.80
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P01275
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)

4-CPD059Mu21
  • EUR 216.48
  • EUR 161.00
  • EUR 536.80
  • EUR 245.60
  • EUR 391.20
  • EUR 208.00
  • EUR 1192.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: P55095
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Mouse Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)

4-CPD059Ra21
  • EUR 216.48
  • EUR 161.00
  • EUR 536.80
  • EUR 245.60
  • EUR 391.20
  • EUR 208.00
  • EUR 1192.00
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: Inquire
  • Buffer composition: PBS, pH 7.4.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): Inquire
  • Isoelectric Point: Inquire
Description: Recombinant Rat Glucagon Like Peptide 2 expressed in: chemical synthesis

Dog Glucagon Like Peptide 2 (GLP2) Peptide (OVA)

20-abx651864
  • EUR 578.00
  • EUR 258.00
  • EUR 1720.00
  • EUR 690.00
  • EUR 425.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

ELISA kit for Mouse GLP2 (Glucagon Like Peptide 2)

ELK7440 1 plate of 96 wells
EUR 432
  • A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) (
  • Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Pig GLP2 (Glucagon Like Peptide 2)

ELK8084 1 plate of 96 wells
EUR 526
  • A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) (
  • Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Pig in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human GLP2(Glucagon Like Peptide 2) ELISA Kit

Scroll to Top