Human GLP2(Glucagon Like Peptide 2) ELISA Kit

Human GLP2(Glucagon Like Peptide 2) ELISA Kit

To Order: Contact us

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
RDR-GLP2-Hu-48Tests	Reddot Biotech	48 Tests	EUR 544

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
RDR-GLP2-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
RD-GLP2-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
RD-GLP2-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Glucagon-Like Peptide 2 (GLP2) Peptide
abx670345-1mg	Abbexa	1 mg	EUR 356
Shipped within 1 week.

Human GLP2(Glucagon Like Peptide 2) ELISA Kit
EH3143	FN Test	96T	EUR 524.1
Detection range: 0.156-10 ng/ml Alias: GLP2/glucagon-like peptide 2
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 0.094 ng/ml

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Human Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Human Glucagon Like Peptide 2 (GLP2) ELISA Kit
4-CED059Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Human Glucagon Like Peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Human Glucagon Like Peptide 2 ELISA Kit (GLP2)
RK01470	Abclonal	96 Tests	EUR 521

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx178980	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx178981	Abbexa	EUR 453.00 EUR 133.00 EUR 1302.00 EUR 620.00 EUR 342.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx178982	Abbexa	EUR 467.00 EUR 133.00 EUR 1358.00 EUR 648.00 EUR 356.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Glucagon Like Peptide 2 (GLP2) Antibody
20-abx130461	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Recombinant Glucagon Like Peptide 2 (GLP2)
4-RPD059Hu01	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P01275 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 11.2kDa Isoelectric Point: 4
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: E.coli

Recombinant Glucagon Like Peptide 2 (GLP2)
4-RPD059Mu01	Cloud-Clone	EUR 440.48 EUR 221.00 EUR 1376.80 EUR 525.60 EUR 951.20 EUR 358.00 EUR 3292.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P55095 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 33.8kDa Isoelectric Point: 4
Description: Recombinant Mouse Glucagon Like Peptide 2 expressed in: E.coli

Pig glucagon like peptide 2(GLP2) ELISA kit
CSB-EQ027317PI-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig glucagon like peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Pig glucagon like peptide 2(GLP2) ELISA kit
1-CSB-EQ027317PI	Cusabio	EUR 900.00 EUR 5476.00 EUR 2900.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Pig glucagon like peptide 2(GLP2) in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4862.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 488.08
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 654.4
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Mu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2644.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Mouse Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12 Show more
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Mouse Glucagon Like Peptide 2 (GLP2) in serum, plasma and other biological fluids.

Mouse Glucagon Like Peptide 2 (GLP2) ELISA Kit
4-CED059Mu	Cloud-Clone	EUR 4913.00 EUR 2595.00 EUR 655.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Mouse Glucagon Like Peptide 2 (GLP2) in samples from Serum, plasma and other biological fluids. with no significant corss-reactivity with analogues from other species.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 5647.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 552.76
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 746.8
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
CED059Po-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 3060.6
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Pig Glucagon Like Peptide 2 (GLP2) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: CV<12%
Description: This is Competitive Enzyme-linked immunosorbent assay for detection of Pig Glucagon Like Peptide 2 (GLP2) in serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.

Pig Glucagon Like Peptide 2 (GLP2) ELISA Kit
4-CED059Po	Cloud-Clone	EUR 5698.00 EUR 3011.00 EUR 747.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Glucagon Like Peptide 2 elisa. Alternative names of the recognized antigen: n/a
Description: Enzyme-linked immunosorbent assay based on the Competitive Inhibition method for detection of Pig Glucagon Like Peptide 2 (GLP2) in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids with no significant corss-reactivity with analogues from other species.

Mouse Glucagon Like Peptide 2 ELISA Kit (GLP2)
RK02852	Abclonal	96 Tests	EUR 521

Porcine Glucagon Like Peptide 2 ELISA Kit (GLP2)
RK03328	Abclonal	96 Tests	EUR 573

Human Glucagon Like Peptide 2 (GLP2) Protein
20-abx652336	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

Human Glucagon Like Peptide 2 (GLP2) Peptide (OVA)
20-abx165542	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Glucagon Like Peptide 2 (GLP2) Peptide (OVA)
20-abx651238	Abbexa	EUR 453.00 EUR 230.00 EUR 1219.00 EUR 523.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

ELISA kit for Human GLP2 (Glucagon Like Peptide 2)
ELK3108	ELK Biotech	1 plate of 96 wells	EUR 432
A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) ( Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)
KTE62531-48T	Abbkine	48T	EUR 332
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)
KTE62531-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Glucagon like peptide 2 (GLP2)
KTE62531-96T	Abbkine	96T	EUR 539
GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 ( Show more
Description: Quantitative sandwich ELISA for measuring Human Glucagon like peptide 2 (GLP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Ca21	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 1536.6Da Isoelectric Point: Inquire
Description: Recombinant Dog Glucagon Like Peptide 2 expressed in: E.coli

OVA conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Hu21	Cloud-Clone	EUR 413.60 EUR 214.00 EUR 1276.00 EUR 492.00 EUR 884.00 EUR 340.00 EUR 3040.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P01275 Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Hu22	Cloud-Clone	EUR 312.35 EUR 187.00 EUR 896.32 EUR 365.44 EUR 630.88 EUR 272.00 EUR 2090.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P01275 Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Human Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Mu21	Cloud-Clone	EUR 216.48 EUR 161.00 EUR 536.80 EUR 245.60 EUR 391.20 EUR 208.00 EUR 1192.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: P55095 Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Mouse Glucagon Like Peptide 2 expressed in: chemical synthesis

OVA Conjugated Glucagon Like Peptide 2 (GLP2)
4-CPD059Ra21	Cloud-Clone	EUR 216.48 EUR 161.00 EUR 536.80 EUR 245.60 EUR 391.20 EUR 208.00 EUR 1192.00	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Rat Glucagon Like Peptide 2 expressed in: chemical synthesis

Dog Glucagon Like Peptide 2 (GLP2) Peptide (OVA)
20-abx651864	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

ELISA kit for Mouse GLP2 (Glucagon Like Peptide 2)
ELK7440	ELK Biotech	1 plate of 96 wells	EUR 432
A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) ( Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Mouse in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

ELISA kit for Pig GLP2 (Glucagon Like Peptide 2)
ELK8084	ELK Biotech	1 plate of 96 wells	EUR 526
A monoclonal antibody specific to Glucagon Like Peptide 2 (GLP2) has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled Glucagon Like Peptide 2 (GLP2) and unlabeled Glucagon Like Peptide 2 (GLP2) ( Show more
Description: A competitive Inhibition ELISA kit for detection of Glucagon Like Peptide 2 from Pig in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Human GLP2(Glucagon Like Peptide 2) ELISA Kit